PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma83g00290.1
Common NameZOSMA_83G00290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 198aa    MW: 22725.6 Da    PI: 9.5568
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma83g00290.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.11.5e-251058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     +ien   r vtf+kRr+g+lKKA+ELSvLCd++v +iifss+gklye s
  Zosma83g00290.1 10 KIENPVYRRVTFCKRRAGLLKKAKELSVLCDVDVGLIIFSSRGKLYELS 58
                     69********************************************976 PP

2K-box55.82e-1983173797
            K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                      + +++ak+++ + e++ Lk+eie+L +  R++ Ge+ e++++++L+ Le+qLe  +  iRs K + ++++ie l++ke  l+ +n+ L ++
  Zosma83g00290.1  83 NVNNQAKSQKAEVEISVLKQEIEMLHKGMRNMFGEGKEKMTYEQLNVLEKQLEVWIYDIRSAKVKNMIQEIESLKNKEMILKAANEILLQE 173
                      34778899******************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.35E-27177IPR002100Transcription factor, MADS-box
SMARTSM004324.4E-33160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.469161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-25323IPR002100Transcription factor, MADS-box
CDDcd002652.61E-35374No hitNo description
PfamPF003195.1E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-253859IPR002100Transcription factor, MADS-box
PfamPF014862.9E-1885172IPR002487Transcription factor, K-box
PROSITE profilePS5129711.04190181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MVRGKVQMRK IENPVYRRVT FCKRRAGLLK KAKELSVLCD VDVGLIIFSS RGKLYELSTK  60
GTIQELVERY LNPSVTESDD SINVNNQAKS QKAEVEISVL KQEIEMLHKG MRNMFGEGKE  120
KMTYEQLNVL EKQLEVWIYD IRSAKVKNMI QEIESLKNKE MILKAANEIL LQEKSAERSI  180
VRIVEEQSGL LNVSQMM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008219077.14e-71PREDICTED: agamous-like MADS-box protein AGL12
SwissprotA2YQK92e-67MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G82e-67MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A0K9NLL31e-140A0A0K9NLL3_Z
STRINGVIT_18s0041g02140.t013e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.14e-56AGAMOUS-like 12